PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G159200.1.p
Common NameSb06g023620, SORBIDRAFT_06g023620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 299aa    MW: 31739.6 Da    PI: 5.9597
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G159200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-171461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+W +eEd+llvd+v+  G+g+W+  ++  g++R++k+c++rw +yl
  Sobic.006G159200.1.p 14 KGPWAPEEDKLLVDYVQANGTGNWRMLPKLAGLNRCGKSCRLRWTNYL 61
                          79********************************************97 PP

2Myb_DNA-binding53.17.2e-1767112148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg++T+eE+  ++++++  G++ W+ Ia+ ++ gRt++++k++w++++
  Sobic.006G159200.1.p  67 RGPFTPEEHNSILQLHAIVGNK-WSMIAAQLP-GRTDNEIKNYWNTHM 112
                           89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.44961IPR017930Myb domain
SuperFamilySSF466892.31E-3111108IPR009057Homeodomain-like
SMARTSM007179.3E-131363IPR001005SANT/Myb domain
PfamPF002494.6E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-231568IPR009057Homeodomain-like
CDDcd001672.33E-91661No hitNo description
PROSITE profilePS5129427.0962116IPR017930Myb domain
SMARTSM007176.7E-1566114IPR001005SANT/Myb domain
PfamPF002491.2E-1467111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-2769116IPR009057Homeodomain-like
CDDcd001679.29E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MGRTPCCDSK GIKKGPWAPE EDKLLVDYVQ ANGTGNWRML PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGPF TPEEHNSILQ LHAIVGNKWS MIAAQLPGRT DNEIKNYWNT HMKKQLRQEG  120
AAAQLATAAA AASSSCPAAR HMAQWEIARL EAEARLSLLS SSATTIASAA TASSSSSTAV  180
AAEHAAPDIF LRLWNSEVGD SFRGAAAVQQ QRHGPEASAA AAAAGVPAQA LPAELGGDDS  240
SAASTYGTEA AADDDYQAFL DLAMEEFTLL QGRLGAFSVF PQADVFADAP CCLFAPFE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0348141e-122BT034814.1 Zea mays full-length cDNA clone ZM_BFb0020L07 mRNA, complete cds.
GenBankKJ7275361e-122KJ727536.1 Zea mays clone pUT5396 MYB-related transcription factor (MYBR113) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002446850.10.0hypothetical protein SORBIDRAFT_06g023620
TrEMBLC5YCX10.0C5YCX1_SORBI; Putative uncharacterized protein Sb06g023620
STRINGSb06g023620.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54093157
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.12e-69myb domain protein 17